Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase lipid-binding protein, mitochondrial (CBG11706)

This Recombinant ATP synthase lipid-binding protein, mitochondrial (CBG11706) spans the amino acid sequence from region 25-116.

Product Specifications

Product Name Alternative

ATP synthase lipid-binding protein, mitochondrial, ATPase protein 9, ATPase subunit c

UniProt

A8XDX2

Expression Region

25-116

Origin

Caenorhabditis briggsae

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENAVAARMISTTVARKDIDSAAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLK QQLFSYAILGFALSEAMGLFCLTMGFMILFAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PDGFRB/CD140b Protein (His Tag)
PKSH031557-01 100 µg

Recombinant Human PDGFRB/CD140b Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PDGFRB/CD140b Protein (His Tag)
PKSH031557-02 1 mg

Recombinant Human PDGFRB/CD140b Protein (His Tag)

Sign In for Pricing
View Details
FITC Anti-Human HLA-A2, B7 Antibody[BB7.6]
AN00634C-01 20 Tests

FITC Anti-Human HLA-A2, B7 Antibody[BB7.6]

Sign In for Pricing
View Details
FITC Anti-Human HLA-A2, B7 Antibody[BB7.6]
AN00634C-02 100 Tests

FITC Anti-Human HLA-A2, B7 Antibody[BB7.6]

Sign In for Pricing
View Details
FITC Anti-Human HLA-A2, B7 Antibody[BB7.6]
AN00634C-03 2x 100 Tests

FITC Anti-Human HLA-A2, B7 Antibody[BB7.6]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS709447 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details