Recombinant ATP synthase lipid-binding protein, mitochondrial (CBG11706)
This Recombinant ATP synthase lipid-binding protein, mitochondrial (CBG11706) spans the amino acid sequence from region 25-116.
Product Specifications
Product Name Alternative
ATP synthase lipid-binding protein, mitochondrial, ATPase protein 9, ATPase subunit c
UniProt
A8XDX2
Expression Region
25-116
Origin
Caenorhabditis briggsae
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MENAVAARMISTTVARKDIDSAAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLK QQLFSYAILGFALSEAMGLFCLTMGFMILFAL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH032394-01 10 µg
Recombinant Human Ephrin-B1/EFNB1 Protein (His Tag)
Sign In for Pricing
View Details PKSH032394-02 50 µg
Recombinant Human Ephrin-B1/EFNB1 Protein (His Tag)
Sign In for Pricing
View Details 