Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bean yellow dwarf virus Movement protein (V2)

This Recombinant Bean yellow dwarf virus Movement protein (V2) spans the amino acid sequence from region 1-92.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

O39519

Expression Region

1-92

Origin

Bean yellow dwarf virus (BeYDV)

Field of Research

Infectious Disease & Virology; Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERILYQVFPSDTNYSYDPPAVTAPSQGSSQTDFGKVVIALVVILVSVGVFYLAYTLFLK DCILLFKAKKQRTTTEIGFGQTPARNQDHPGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Water Chiller BCHI-207
BCHI-207 Each

Water Chiller BCHI-207

Sign In for Pricing
View Details
(R)-Jorgensen-Hayashi Catalyst
TRC-J212020-2.5G 2.5 g

(R)-Jorgensen-Hayashi Catalyst

Sign In for Pricing
View Details
Yy2 Mouse Gene Knockout Kit (CRISPR)
KN519578 1 Kit

Yy2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Benzyl 2-Acetamido-4,6-O-benzylidene-2-deoxy-a-D-glucopyranoside
TRC-B211000-5G 5 g

Benzyl 2-Acetamido-4,6-O-benzylidene-2-deoxy-a-D-glucopyranoside

Sign In for Pricing
View Details
ITS1-ITS2 Library Preparation Kit for Illumina (Set B)
71020 96 Preparations

ITS1-ITS2 Library Preparation Kit for Illumina (Set B)

Sign In for Pricing
View Details
FAM38A/PIEZO1 Mouse Monoclonal Antibody [2-10]
M1005-2 100 µL

FAM38A/PIEZO1 Mouse Monoclonal Antibody [2-10]

Sign In for Pricing
View Details