Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bean yellow dwarf virus Movement protein (V2)

This Recombinant Bean yellow dwarf virus Movement protein (V2) spans the amino acid sequence from region 1-92.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

O39519

Expression Region

1-92

Origin

Bean yellow dwarf virus (BeYDV)

Field of Research

Infectious Disease & Virology; Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERILYQVFPSDTNYSYDPPAVTAPSQGSSQTDFGKVVIALVVILVSVGVFYLAYTLFLK DCILLFKAKKQRTTTEIGFGQTPARNQDHPGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ENTR1 activation kit by CRISPRa
GA107407 1 Kit

Human ENTR1 activation kit by CRISPRa

Sign In for Pricing
View Details
Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6F10]
TA503617BM 100 µL

Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6F10]

Sign In for Pricing
View Details
Bullet Ice Maker BIBU-109
BIBU-109 1 Unit

Bullet Ice Maker BIBU-109

Sign In for Pricing
View Details
ZNF447 (ZSCAN18) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H7]
TA505326BM 100 µL

ZNF447 (ZSCAN18) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H7]

Sign In for Pricing
View Details
BioCoupler® x 12
BC12 12 Each

BioCoupler® x 12

Sign In for Pricing
View Details
HABP4 Rabbit Polyclonal Antibody
TA376909 100 µL

HABP4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details