Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bean yellow dwarf virus Movement protein (V2)

This Recombinant Bean yellow dwarf virus Movement protein (V2) spans the amino acid sequence from region 1-92.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

O39519

Expression Region

1-92

Origin

Bean yellow dwarf virus (BeYDV)

Field of Research

Infectious Disease & Virology; Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERILYQVFPSDTNYSYDPPAVTAPSQGSSQTDFGKVVIALVVILVSVGVFYLAYTLFLK DCILLFKAKKQRTTTEIGFGQTPARNQDHPGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethylene Terephthalate Cyclic Heptamer-d28
TRC-E918177-1MG 1 mg

Ethylene Terephthalate Cyclic Heptamer-d28

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS705952 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Human Chromobox Homolog 3 (CBX3) ELISA Kit
RD-CBX3-Hu-01 96 Tests

Human Chromobox Homolog 3 (CBX3) ELISA Kit

Sign In for Pricing
View Details
Human Chromobox Homolog 3 (CBX3) ELISA Kit
RD-CBX3-Hu-02 48 Tests

Human Chromobox Homolog 3 (CBX3) ELISA Kit

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3284), CF640R conjugate, 0.1mg/mL
BNC403284-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3284), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Goat anti-Mouse IgG Coated - 96 well Solid plates - Black PS
MCB25F-aM 10x 96 Well Plates

Goat anti-Mouse IgG Coated - 96 well Solid plates - Black PS

Sign In for Pricing
View Details