Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1223 (MJ1223)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1223 (MJ1223) spans the amino acid sequence from region 1-92.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1223

UniProt

Q58620

Expression Region

1-92

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIYVWLFAIIALSFSALVGLRLSFKKGTANVLVGESIITVVAGTLIVVISQKYNLAFAD TIALAIFICGVVGAFAFCKVIGGDNEKAKQPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HACE1 Antibody - N-terminal region (ARP43276_P050)
ARP43276_P050 100 µL

HACE1 Antibody - N-terminal region (ARP43276_P050)

Sign In for Pricing
View Details
OTUB2 Recombinant Protein
orb1229655 0.05 mg

OTUB2 Recombinant Protein

Sign In for Pricing
View Details
Human progranulin (PGRN) Elisa Kit
EK713422 96 Well

Human progranulin (PGRN) Elisa Kit

Sign In for Pricing
View Details
KY Rabbit Polyclonal Antibody (RBITC)
orb1014320 100 µL

KY Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
MSL3L1 (MSL3) (NM_078629) Human Recombinant Protein
PROTQ8N5Y2 20 µg

MSL3L1 (MSL3) (NM_078629) Human Recombinant Protein

Sign In for Pricing
View Details
IGO (GPI Ethanolamine Phosphate Transferase 3 , Phosphatidylinositol Glycan Anchor Biosynthesis, Class O)
483408 100 µL

IGO (GPI Ethanolamine Phosphate Transferase 3 , Phosphatidylinositol Glycan Anchor Biosynthesis, Class O)

Sign In for Pricing
View Details