Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Dolichol-phosphate mannosyltransferase subunit 3 (DPM3)

This Recombinant Pongo abelii Dolichol-phosphate mannosyltransferase subunit 3 (DPM3) spans the amino acid sequence from region 1-92.

Product Specifications

Product Name Alternative

Dolichol-phosphate mannosyltransferase subunit 3, DPM synthase complex subunit 3, Dolichol-phosphate mannose synthase subunit 3, Dolichyl-phosphate beta-D-mannosyltransferase subunit 3, Mannose-P-doli

UniProt

Q5R8B1

Expression Region

1-92

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKLAQWLWGLAILGSTWAALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYR VATFHDCEDAARELQSQIQEARADLARRGLRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRP alpha (SIRPA) Mouse Monoclonal Antibody [Clone ID: OTI2G6]
CF807752 100 µg

SIRP alpha (SIRPA) Mouse Monoclonal Antibody [Clone ID: OTI2G6]

Sign In for Pricing
View Details
BZW2 (NM_001159767) Human Over-expression Lysate
LY431914 100 µg

BZW2 (NM_001159767) Human Over-expression Lysate

Sign In for Pricing
View Details
PGRP1B (PGLYRP4) (NM_020393) Human Recombinant Protein
TP324039L 1 mg

PGRP1B (PGLYRP4) (NM_020393) Human Recombinant Protein

Sign In for Pricing
View Details
Sclareol (~90%)
TRC-S199970-1G 1 g

Sclareol (~90%)

Sign In for Pricing
View Details
L-Glutamic Acid alpha-Ethyl Ester
TRC-G616990-1G 1 g

L-Glutamic Acid alpha-Ethyl Ester

Sign In for Pricing
View Details
TAF11 (NM_005643) Human Recombinant Protein
TP303466 20 µg

TAF11 (NM_005643) Human Recombinant Protein

Sign In for Pricing
View Details