Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Dolichol-phosphate mannosyltransferase subunit 3 (DPM3)

This Recombinant Pongo abelii Dolichol-phosphate mannosyltransferase subunit 3 (DPM3) spans the amino acid sequence from region 1-92.

Product Specifications

Product Name Alternative

Dolichol-phosphate mannosyltransferase subunit 3, DPM synthase complex subunit 3, Dolichol-phosphate mannose synthase subunit 3, Dolichyl-phosphate beta-D-mannosyltransferase subunit 3, Mannose-P-doli

UniProt

Q5R8B1

Expression Region

1-92

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKLAQWLWGLAILGSTWAALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYR VATFHDCEDAARELQSQIQEARADLARRGLRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP4R2 Human Gene Knockout Kit (CRISPR)
KN220738 1 Kit

PPP4R2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF640R conjugate, 0.1mg/mL
BNC402172-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AGL Human Knockdown Lysate
LY300028 100 µg

AGL Human Knockdown Lysate

Sign In for Pricing
View Details
GPX4 Recombinant Rabbit Monoclonal Antibody [JU11-31]
ET1706-45 100 µL

GPX4 Recombinant Rabbit Monoclonal Antibody [JU11-31]

Sign In for Pricing
View Details
CD1c (CD1C/1603), CF405S conjugate, 0.1mg/mL
BNC041603-500 1x 500 µL

CD1c (CD1C/1603), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (C6/372), 1mg/mL
BNUM0372-50 1x 50 µL

CD6 (C6/372), 1mg/mL

Sign In for Pricing
View Details