Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Dolichol-phosphate mannosyltransferase subunit 3 (DPM3)

This Recombinant Pongo abelii Dolichol-phosphate mannosyltransferase subunit 3 (DPM3) spans the amino acid sequence from region 1-92.

Product Specifications

Product Name Alternative

Dolichol-phosphate mannosyltransferase subunit 3, DPM synthase complex subunit 3, Dolichol-phosphate mannose synthase subunit 3, Dolichyl-phosphate beta-D-mannosyltransferase subunit 3, Mannose-P-doli

UniProt

Q5R8B1

Expression Region

1-92

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKLAQWLWGLAILGSTWAALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYR VATFHDCEDAARELQSQIQEARADLARRGLRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,3'-Oxybis(1-(isopropylamino)propan-2-ol) dihydrochloride
TRC-O412890-25MG 25 mg

3,3'-Oxybis(1-(isopropylamino)propan-2-ol) dihydrochloride

Sign In for Pricing
View Details
Tissue Protein Lysate, Kidney
CP565387 150 µg

Tissue Protein Lysate, Kidney

Sign In for Pricing
View Details
Z-Lys(z)-osu
TRC-L488848-500MG 500 mg

Z-Lys(z)-osu

Sign In for Pricing
View Details
MSI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F4]
TA502420BM 100 µL

MSI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F4]

Sign In for Pricing
View Details
APC Anti-Human CD274/PD-L1 Antibody[29E.2A3]
E-AB-F1133E-01 20 Tests

APC Anti-Human CD274/PD-L1 Antibody[29E.2A3]

Sign In for Pricing
View Details
APC Anti-Human CD274/PD-L1 Antibody[29E.2A3]
E-AB-F1133E-02 100 Tests

APC Anti-Human CD274/PD-L1 Antibody[29E.2A3]

Sign In for Pricing
View Details