Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Structural protein VP3 (VP3)

This Recombinant Structural protein VP3 (VP3) spans the amino acid sequence from region 1-92.

Product Specifications

Product Name Alternative

Structural protein VP3

UniProt

Q6UG62

Expression Region

1-92

Origin

Sulfolobus virus-like particle SSV2

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEELNIKQILFLAIFLVIGVVLFQPIISYVNNVTTSGTYTTIISGTLTQTSFVSNPNYVG SSNAPLVSLVPLFYLIVLIVVPAVVAYKIYKD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Schizosaccharomyces pombe Protein ral2 (ral2), partial
MBS1184803 Inquire

Recombinant Schizosaccharomyces pombe Protein ral2 (ral2), partial

Sign In for Pricing
View Details
Human Interleukin 1 receptor antagonist ELISA Kit
MBS730074-01 48 Well

Human Interleukin 1 receptor antagonist ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 1 receptor antagonist ELISA Kit
MBS730074-02 96 Well

Human Interleukin 1 receptor antagonist ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 1 receptor antagonist ELISA Kit
MBS730074-03 5x 96 Well

Human Interleukin 1 receptor antagonist ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 1 receptor antagonist ELISA Kit
MBS730074-04 10x 96 Well

Human Interleukin 1 receptor antagonist ELISA Kit

Sign In for Pricing
View Details
Human Factor Related Apoptosis Ligand (FASL) Mini Samples ELISA Kit
MBS2087154-01 24 Strip Well

Human Factor Related Apoptosis Ligand (FASL) Mini Samples ELISA Kit

Sign In for Pricing
View Details