Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Structural protein VP3 (VP3)

This Recombinant Structural protein VP3 (VP3) spans the amino acid sequence from region 1-92.

Product Specifications

Product Name Alternative

Structural protein VP3

UniProt

Q6UG62

Expression Region

1-92

Origin

Sulfolobus virus-like particle SSV2

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEELNIKQILFLAIFLVIGVVLFQPIISYVNNVTTSGTYTTIISGTLTQTSFVSNPNYVG SSNAPLVSLVPLFYLIVLIVVPAVVAYKIYKD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish USP6 N-Terminal Like Protein ELISA Kit
MBS088135 Inquire

Fish USP6 N-Terminal Like Protein ELISA Kit

Sign In for Pricing
View Details
Triticum vulgare, Succinylated (WGA, Wheat Germ, Agglutinin) (Agarose)
T8653-45A-01 2 mL

Triticum vulgare, Succinylated (WGA, Wheat Germ, Agglutinin) (Agarose)

Sign In for Pricing
View Details
Triticum vulgare, Succinylated (WGA, Wheat Germ, Agglutinin) (Agarose)
T8653-45A-02 5 mL

Triticum vulgare, Succinylated (WGA, Wheat Germ, Agglutinin) (Agarose)

Sign In for Pricing
View Details
H2-Ea-ps siRNA Oligos set (Mouse)
22916174 3x 5 nmol

H2-Ea-ps siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Keratin 17/19 Rabbit mAb
F1496-100uL*2 2x 100 μL

Keratin 17/19 Rabbit mAb

Sign In for Pricing
View Details
CCDC54 (NM_032600) Human Tagged ORF Clone Lentiviral Particle
RC205400L4V 200 µL

CCDC54 (NM_032600) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details