Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase lipid-binding protein, mitochondrial (Y82E9BR.3)

This Recombinant ATP synthase lipid-binding protein, mitochondrial (Y82E9BR.3) spans the amino acid sequence from region 25-116.

Product Specifications

Product Name Alternative

ATP synthase lipid-binding protein, mitochondrial, ATP synthase c subunit, ATPase protein 9, ATPase subunit c

UniProt

Q9BKS0

Expression Region

25-116

Origin

Caenorhabditis elegans

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENAVAARMISTTVARKDIDSAAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLK QQLFSYAILGFALSEAMGLFCLTMGFMILFAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4930555G01Rik (NM_175393) Mouse Tagged ORF Clone
MR215100 10 µg

4930555G01Rik (NM_175393) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SMEK3P ORF Vector (Human) (pORF)
44447011 1.0 µg DNA

SMEK3P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SUGP2 polyclonal antibody
orb648157-01 50 μL

SUGP2 polyclonal antibody

Sign In for Pricing
View Details
SUGP2 polyclonal antibody
orb648157-02 100 µL

SUGP2 polyclonal antibody

Sign In for Pricing
View Details
SUGP2 polyclonal antibody
orb648157-03 200 µL

SUGP2 polyclonal antibody

Sign In for Pricing
View Details
Nkx3-2 Rabbit Polyclonal Antibody
TA341748 100 µL

Nkx3-2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details