Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase lipid-binding protein, mitochondrial (Y82E9BR.3)

This Recombinant ATP synthase lipid-binding protein, mitochondrial (Y82E9BR.3) spans the amino acid sequence from region 25-116.

Product Specifications

Product Name Alternative

ATP synthase lipid-binding protein, mitochondrial, ATP synthase c subunit, ATPase protein 9, ATPase subunit c

UniProt

Q9BKS0

Expression Region

25-116

Origin

Caenorhabditis elegans

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENAVAARMISTTVARKDIDSAAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLK QQLFSYAILGFALSEAMGLFCLTMGFMILFAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Annexin V siRNA
abx907674-01 15 nmol

Mouse Annexin V siRNA

Sign In for Pricing
View Details
Mouse Annexin V siRNA
abx907674-02 30 nmol

Mouse Annexin V siRNA

Sign In for Pricing
View Details
PEPP2 Rabbit Polyclonal Antibody
orb312737-01 50 μL

PEPP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PEPP2 Rabbit Polyclonal Antibody
orb312737-02 100 µL

PEPP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PEPP2 Rabbit Polyclonal Antibody
orb312737-03 200 µL

PEPP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human PSCA Antibody (SAA0474), FITC
MBS1582309-01 50 Tests

Anti-Human PSCA Antibody (SAA0474), FITC

Sign In for Pricing
View Details