Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dolichol-phosphate mannosyltransferase subunit 3 (DPM3)

This Recombinant Human Dolichol-phosphate mannosyltransferase subunit 3 (DPM3) spans the amino acid sequence from region 1-92.

Product Specifications

Product Name Alternative

Dolichol-phosphate mannosyltransferase subunit 3, DPM synthase complex subunit 3, Dolichol-phosphate mannose synthase subunit 3, Dolichyl-phosphate beta-D-mannosyltransferase subunit 3, Mannose-P-doli

UniProt

Q9P2X0

Expression Region

1-92

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYR VATFHDCEDAARELQSQIQEARADLARRGLRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mesp1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6647304 1.0 µg DNA

Mesp1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Human Fibulin 4 (FBLN4) ELISA Kit
orb1949802-01 48 Tests

Human Fibulin 4 (FBLN4) ELISA Kit

Sign In for Pricing
View Details
Human Fibulin 4 (FBLN4) ELISA Kit
orb1949802-02 96 Tests

Human Fibulin 4 (FBLN4) ELISA Kit

Sign In for Pricing
View Details
Vinylbenzyl Chloride, Mixture of 2, 3- and 4-isomers (Stabilized with TBC)
TRC-V757053-1G 1 g

Vinylbenzyl Chloride, Mixture of 2, 3- and 4-isomers (Stabilized with TBC)

Sign In for Pricing
View Details
Gm10058 siRNA Oligos set (Mouse)
21677174 3x 5 nmol

Gm10058 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
FANCI Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
20236061 1.0 µg DNA

FANCI Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details