Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dolichol-phosphate mannosyltransferase subunit 3 (DPM3)

This Recombinant Human Dolichol-phosphate mannosyltransferase subunit 3 (DPM3) spans the amino acid sequence from region 1-92.

Product Specifications

Product Name Alternative

Dolichol-phosphate mannosyltransferase subunit 3, DPM synthase complex subunit 3, Dolichol-phosphate mannose synthase subunit 3, Dolichyl-phosphate beta-D-mannosyltransferase subunit 3, Mannose-P-doli

UniProt

Q9P2X0

Expression Region

1-92

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYR VATFHDCEDAARELQSQIQEARADLARRGLRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB1 protein (His tag)
80R-1120 0.1 mg

PSMB1 protein (His tag)

Sign In for Pricing
View Details
Mouse Monoclonal RMND5A Antibody (OTI2C8) [Alexa Fluor 647]
NBP2-73918AF647 0.1 mL

Mouse Monoclonal RMND5A Antibody (OTI2C8) [Alexa Fluor 647]

Sign In for Pricing
View Details
PARP11 Antibody
orb253038 100 µL

PARP11 Antibody

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PVA22 Polyclonal Antibody
MBS7178372 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PVA22 Polyclonal Antibody

Sign In for Pricing
View Details
Human CDIPT shRNA Plasmid
abx957068-01 150 µg

Human CDIPT shRNA Plasmid

Sign In for Pricing
View Details
Human CDIPT shRNA Plasmid
abx957068-02 300 µg

Human CDIPT shRNA Plasmid

Sign In for Pricing
View Details