Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Structural protein VP3 (VP3)

This Recombinant Structural protein VP3 (VP3) spans the amino acid sequence from region 1-92.

Product Specifications

Product Name Alternative

Structural protein VP3

UniProt

P20225

Expression Region

1-92

Origin

Sulfolobus virus-like particle SSV1

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEISLKPIIFLVVFIIVGIALFGPINSVVNNVTTSGTYTTIVSGTVTTSSFVSNPQYVGS NNATIVALVPLFYILVLIIVPAVVAYKLYKEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZP2 Antibody [Alexa Fluor 647]
NBP2-97981AF647 0.1 mL

Rabbit Polyclonal ZP2 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Anxa11 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6014403 1.0 µg DNA

Anxa11 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
pDNR-LIB-KCTD6 Plasmid
PVT27879 2 µg

pDNR-LIB-KCTD6 Plasmid

Sign In for Pricing
View Details
Recombinant Macropus parma Cytochrome c oxidase subunit 5A, mitochondrial (COX5A)
MBS1006638-01 0.02 mg (E-Coli)

Recombinant Macropus parma Cytochrome c oxidase subunit 5A, mitochondrial (COX5A)

Sign In for Pricing
View Details
Recombinant Macropus parma Cytochrome c oxidase subunit 5A, mitochondrial (COX5A)
MBS1006638-02 0.1 mg (E-Coli)

Recombinant Macropus parma Cytochrome c oxidase subunit 5A, mitochondrial (COX5A)

Sign In for Pricing
View Details
Recombinant Macropus parma Cytochrome c oxidase subunit 5A, mitochondrial (COX5A)
MBS1006638-03 0.02 mg (Yeast)

Recombinant Macropus parma Cytochrome c oxidase subunit 5A, mitochondrial (COX5A)

Sign In for Pricing
View Details