Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Structural protein VP3 (VP3)

This Recombinant Structural protein VP3 (VP3) spans the amino acid sequence from region 1-92.

Product Specifications

Product Name Alternative

Structural protein VP3

UniProt

P20225

Expression Region

1-92

Origin

Sulfolobus virus-like particle SSV1

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEISLKPIIFLVVFIIVGIALFGPINSVVNNVTTSGTYTTIVSGTVTTSSFVSNPQYVGS NNATIVALVPLFYILVLIIVPAVVAYKLYKEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Candida Albicans TUB2 Protein (aa 1-449)
VAng-Lsx06041-500gEcoli 500 µg (E. coli)

Recombinant Candida Albicans TUB2 Protein (aa 1-449)

Sign In for Pricing
View Details
SLC25A46 Protein Vector (Human) (pPM-C-His)
PV038548 500 ng

SLC25A46 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
MDH1 (Malate Dehydrogenase, Cytoplasmic, Cytosolic Malate Dehydrogenase, Diiodophenylpyruvate Reductase, MDHA) (Biotin)
129517-Biotin 100 µL

MDH1 (Malate Dehydrogenase, Cytoplasmic, Cytosolic Malate Dehydrogenase, Diiodophenylpyruvate Reductase, MDHA) (Biotin)

Sign In for Pricing
View Details
IL31 Rabbit Polyclonal Antibody
orb2954802-01 50 µg

IL31 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL31 Rabbit Polyclonal Antibody
orb2954802-02 100 µg

IL31 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni coaX Protein (aa 1-209)
VAng-Lsx6223-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Jejuni coaX Protein (aa 1-209)

Sign In for Pricing
View Details