Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Envelope small membrane protein (E)

This Recombinant Avian infectious bronchitis virus Envelope small membrane protein (E) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein, 3c protein

UniProt

P30246

Expression Region

1-93

Origin

Avian infectious bronchitis virus (strain Portugal/322/82) (IBV)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMNLLNKSLEENGSVLTAFYIFVAFVALYLLGRALQAFVQAADACCLFWYTWVVVPGAKG TTFVYKHTYGKKLNKPELETVIVNEFPKNGWKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Bromobenzotrifluoride
28370667-25g 25 g

4-Bromobenzotrifluoride

Sign In for Pricing
View Details
Mouse Evx2 Pre-designed siRNA Set A
SI104495A 1 Each

Mouse Evx2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral mouse Ccdc86 shRNA (UAS) - Lentiviral mouse Ccdc86 shRNA (UAS, iRFP) (100)
GTR15247743 1 Vial

Lentiviral mouse Ccdc86 shRNA (UAS) - Lentiviral mouse Ccdc86 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
NQO2 Rabbit Monoclonal Antibody [Clone ID: 24GB250]
TA425017 100 µL

NQO2 Rabbit Monoclonal Antibody [Clone ID: 24GB250]

Sign In for Pricing
View Details
EM 163
MBS5785774 Inquire

EM 163

Sign In for Pricing
View Details
NES siRNA (Rat)
MBS8240394-01 15 nmol

NES siRNA (Rat)

Sign In for Pricing
View Details