Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage P2 Holin (Y)

This Recombinant Enterobacteria phage P2 Holin (Y) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Holin

UniProt

P51773

Expression Region

1-93

Origin

Enterobacteria phage P2 (Bacteriophage P2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAEEKSVLSLFMIGVLIVVGKVLAGGEPITPRLFIGRMLLGGFVSMVAGVVLVQFPDLS LPAVCGIGSMLGIAGYQVIEIAIQRRFKGRGKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B Raf (BRAF) (NM_004333) Human Over-expression Lysate
LY401382 100 µg

B Raf (BRAF) (NM_004333) Human Over-expression Lysate

Sign In for Pricing
View Details
1-Octanoyl-2-decanoyl-3-chloropropanediol
TRC-O238460-10MG 10 mg

1-Octanoyl-2-decanoyl-3-chloropropanediol

Sign In for Pricing
View Details
TPMT (NM_000367) Human Over-expression Lysate
LY400131 100 µg

TPMT (NM_000367) Human Over-expression Lysate

Sign In for Pricing
View Details
P Glycoprotein (ABCB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C8]
TA801003AM 100 µL

P Glycoprotein (ABCB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C8]

Sign In for Pricing
View Details
GF-1 Blood Tissue Combi DNA Extraction Kit (Proteinase K included), 50 preps
GF-BT-050 50 Preparations

GF-1 Blood Tissue Combi DNA Extraction Kit (Proteinase K included), 50 preps

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703812 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details