Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage P2 Holin (Y)

This Recombinant Enterobacteria phage P2 Holin (Y) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Holin

UniProt

P51773

Expression Region

1-93

Origin

Enterobacteria phage P2 (Bacteriophage P2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAEEKSVLSLFMIGVLIVVGKVLAGGEPITPRLFIGRMLLGGFVSMVAGVVLVQFPDLS LPAVCGIGSMLGIAGYQVIEIAIQRRFKGRGKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI5D11]
CF810894 100 µg

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI5D11]

Sign In for Pricing
View Details
SIAH1 Human Gene Knockout Kit (CRISPR)
KN206576RB 1 Kit

SIAH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alox12 Mouse Gene Knockout Kit (CRISPR)
KN301155RB 1 Kit

Alox12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human HPDL activation kit by CRISPRa
GA113715 1 Kit

Human HPDL activation kit by CRISPRa

Sign In for Pricing
View Details
PADI2 Antibody
KC-1207-01 50 μL

PADI2 Antibody

Sign In for Pricing
View Details
PADI2 Antibody
KC-1207-02 100 µL

PADI2 Antibody

Sign In for Pricing
View Details