Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri Cobalt transport protein CbiN (cbiN)

This Recombinant Citrobacter koseri Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

A8AEQ5

Expression Region

1-93

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKTLILLAMVIALVILPFFIDHGGEFGGSDGEAESQIQVVAPHYEPWFQPLYEPASGEI ESLLFTLQGSLGAAVIFYILGYSKGRQRRDDRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella typhimurium Invasion lipoprotein invH (invH)
MBS1008501-01 0.02 mg (E-Coli)

Recombinant Salmonella typhimurium Invasion lipoprotein invH (invH)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Invasion lipoprotein invH (invH)
MBS1008501-02 0.1 mg (E-Coli)

Recombinant Salmonella typhimurium Invasion lipoprotein invH (invH)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Invasion lipoprotein invH (invH)
MBS1008501-03 0.02 mg (Yeast)

Recombinant Salmonella typhimurium Invasion lipoprotein invH (invH)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Invasion lipoprotein invH (invH)
MBS1008501-04 0.1 mg (Yeast)

Recombinant Salmonella typhimurium Invasion lipoprotein invH (invH)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Invasion lipoprotein invH (invH)
MBS1008501-05 0.02 mg (Baculovirus)

Recombinant Salmonella typhimurium Invasion lipoprotein invH (invH)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Invasion lipoprotein invH (invH)
MBS1008501-06 0.02 mg (Mammalian-Cell)

Recombinant Salmonella typhimurium Invasion lipoprotein invH (invH)

Sign In for Pricing
View Details