Recombinant Citrobacter koseri Cobalt transport protein CbiN (cbiN)
This Recombinant Citrobacter koseri Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-93.
Product Specifications
Product Name Alternative
Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN
UniProt
A8AEQ5
Expression Region
1-93
Origin
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKKTLILLAMVIALVILPFFIDHGGEFGGSDGEAESQIQVVAPHYEPWFQPLYEPASGEI ESLLFTLQGSLGAAVIFYILGYSKGRQRRDDRA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
138284-APC 100 µL
RBP1 (Retinol-binding Protein 1, Cellular Retinol-binding Protein, CRBP, Cellular Retinol-binding Protein I, CRBP-I, CRBP1) (APC)
Sign In for Pricing
View Details orb3095066 100 µg
BAP29/BCAP29 Rabbit Polyclonal Antibody (Carrier-free)
Sign In for Pricing
View Details NKD36715-01 50 mg
Rac-3-Cyclopropyl-5-[ (3R,4R) -4-cyclopropylpyrrolidin-3-yl]-1H-1,2,4-triazole dihydrochloride
Sign In for Pricing
View Details