Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium marinum UPF0233 membrane protein MMAR_0013 (MMAR_0013)

This Recombinant Mycobacterium marinum UPF0233 membrane protein MMAR_0013 (MMAR_0013) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

UPF0233 membrane protein MMAR_0013

UniProt

B2HI58

Expression Region

1-93

Origin

Mycobacterium marinum (strain ATCC BAA-535 / M)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPKSKVRKKNDFTVKPVSRTPVKVKVGPSSVWFVALFIGLMLIGLVWLMVFQLAAVGSQA PAALNWMAQLGPWNYAIAFAFMITGLLLTMRWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog