Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Cobalt transport protein CbiN (cbiN)

This Recombinant Salmonella paratyphi C Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

C0Q1Q4

Expression Region

1-93

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKTLMLLAMVVALVILPFFINHGGEYGGSDGEAESQIQALAPQYKPWFQPLYEPASGEI ESLLFTLQGSLGAAVIFYILGYCKGKQRRDDRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (ALP/870), CF568 conjugate, 0.1mg/mL
BNC680870-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (ALP/870), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (3H9), CF555 conjugate, 0.1mg/mL
BNC550242-100 1x 100 µL

PTH / Parathyroid Hormone (N-Terminal) (3H9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (124), CF594 conjugate, 0.1mg/mL
BNC940530-100 1x 100 µL

Bcl-2 (124), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF647 conjugate, 0.1mg/mL
BNC472497-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Blood Group Antigen B (CD173) (HEB-20), CF405S conjugate, 0.1mg/mL
BNC040296-500 1x 500 µL

Blood Group Antigen B (CD173) (HEB-20), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details