Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Microcin-24 immunity protein (mtfI)

This Recombinant Microcin-24 immunity protein (mtfI) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Microcin-24 immunity protein

UniProt

Q46970

Expression Region

1-93

Origin

Escherichia coli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFLNFAFSPVFFSIMACYFIVWRNKRNEFVCNRLLSIIIISFLICFIYPWLNYKIEVKY YIFEQFYLFCFLSSLVAVVINLIVYFILYRRCI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSA/KLK3 (D6B1) XP®Rabbit Monoclonal Antibody
CST 5365T 20 µL

PSA/KLK3 (D6B1) XP®Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Aquaporin 4/AQP4 Rabbit Polyclonal Antibody (HRP)
orb2596246 100 µg

Aquaporin 4/AQP4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
PLCG2 gRNA3
G007c 10 µg

PLCG2 gRNA3

Sign In for Pricing
View Details
Recombinant Cynomolgus B2M (C-Fc)
PHV1991-01 10 µg

Recombinant Cynomolgus B2M (C-Fc)

Sign In for Pricing
View Details
Recombinant Cynomolgus B2M (C-Fc)
PHV1991-02 50 µg

Recombinant Cynomolgus B2M (C-Fc)

Sign In for Pricing
View Details
Recombinant Cynomolgus B2M (C-Fc)
PHV1991-03 500 µg

Recombinant Cynomolgus B2M (C-Fc)

Sign In for Pricing
View Details