Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Microcin-24 immunity protein (mtfI)

This Recombinant Microcin-24 immunity protein (mtfI) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Microcin-24 immunity protein

UniProt

Q46970

Expression Region

1-93

Origin

Escherichia coli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFLNFAFSPVFFSIMACYFIVWRNKRNEFVCNRLLSIIIISFLICFIYPWLNYKIEVKY YIFEQFYLFCFLSSLVAVVINLIVYFILYRRCI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Eotaxin 1 ELISA Kit
ECE0371 96 Tests

Canine Eotaxin 1 ELISA Kit

Sign In for Pricing
View Details
PPP6C (Protein Phosphatase 6, Catalytic Subunit, PP6, PP6C) (MaxLight 750)
MBS6432753-01 0.1 mL

PPP6C (Protein Phosphatase 6, Catalytic Subunit, PP6, PP6C) (MaxLight 750)

Sign In for Pricing
View Details
PPP6C (Protein Phosphatase 6, Catalytic Subunit, PP6, PP6C) (MaxLight 750)
MBS6432753-02 5x 0.1 mL

PPP6C (Protein Phosphatase 6, Catalytic Subunit, PP6, PP6C) (MaxLight 750)

Sign In for Pricing
View Details
Goat Sine oculis binding protein homolog (SOBP) ELISA Kit
GTR10353249 96 Well

Goat Sine oculis binding protein homolog (SOBP) ELISA Kit

Sign In for Pricing
View Details
SREBP2 Polyclonal Antibody, Cy5.5 Conjugated
bs-2536R-Cy5.5 100 µL

SREBP2 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
IRGQ (NM_001007561) Human Untagged Clone
SC301246 10 µg

IRGQ (NM_001007561) Human Untagged Clone

Sign In for Pricing
View Details