Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1617 (MJ1617)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1617 (MJ1617) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1617

UniProt

Q59012

Expression Region

1-93

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMKPILIFLGIILMFIGFFMITLGMILPSSQENYEKPETEKTESSVEYSGIVMIGPIPI VFGNSPGLMILSVLIAILMIIWMFLFAFGIRIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPA2 Antibody - C-terminal region : HRP (ARP62495_P050-HRP)
ARP62495_P050-HRP 100 µL

RPA2 Antibody - C-terminal region : HRP (ARP62495_P050-HRP)

Sign In for Pricing
View Details
ABCA1 Rabbit pAb
E45R27221N-50 50 µL

ABCA1 Rabbit pAb

Sign In for Pricing
View Details
Cwc15 (NM_023153) Mouse Recombinant Protein
E45M48062M5 20 µg

Cwc15 (NM_023153) Mouse Recombinant Protein

Sign In for Pricing
View Details
CGKII Polyclonal Antibody
E040736 100 µg -100 µL

CGKII Polyclonal Antibody

Sign In for Pricing
View Details
AChRα1 (h) : 293T Lysate
sc-158225 100 µg - 200 µL

AChRα1 (h) : 293T Lysate

Sign In for Pricing
View Details
Goat F(Ab')2 Anti Mouse Igg (H/L) Polyclonal Antibody
CPBT-68113GA 0.8 mg

Goat F(Ab')2 Anti Mouse Igg (H/L) Polyclonal Antibody

Sign In for Pricing
View Details