Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1617 (MJ1617)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1617 (MJ1617) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1617

UniProt

Q59012

Expression Region

1-93

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMKPILIFLGIILMFIGFFMITLGMILPSSQENYEKPETEKTESSVEYSGIVMIGPIPI VFGNSPGLMILSVLIAILMIIWMFLFAFGIRIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Brucella Abortus rplW Protein (aa 1-97)
VAng-Lsx5311-500gEcoli 500 µg (E. coli)

Recombinant Brucella Abortus rplW Protein (aa 1-97)

Sign In for Pricing
View Details
Phospho-Smad3 (Thr179) Peptide
AF3363-BP 1 mg

Phospho-Smad3 (Thr179) Peptide

Sign In for Pricing
View Details
SIX3 Rabbit Polyclonal Antibody
orb329653 100 µL

SIX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MMEL1 Protein Vector (Mouse) (pPB-N-His)
PV201227 500 ng

MMEL1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
NXN Antibody - middle region
OAAB08754-400UL 400 µL

NXN Antibody - middle region

Sign In for Pricing
View Details
PIGV Human Over-expression Lysate
orb1369580 20 µg

PIGV Human Over-expression Lysate

Sign In for Pricing
View Details