Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0574 (MJ0574)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0574 (MJ0574) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0574

UniProt

Q57994

Expression Region

1-93

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWPCPIGFGMVGFPIFGFFFMGLFFVIGIAVFIIIIITIVDILKRDALDTLEKILWILVV WFLGIIGAIIYYLLSKRNSKSKGDNNGKNIGSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-EGFP-Ddx1-3xFLAG-Neo Plasmid
PVT66994 2 µg

PCMV-EGFP-Ddx1-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
Olr300 3'UTR Luciferase Stable Cell Line
TU215094 1.0 mL

Olr300 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
BMP6 Antibody
orb1313083-01 30 µL

BMP6 Antibody

Sign In for Pricing
View Details
BMP6 Antibody
orb1313083-02 50 μL

BMP6 Antibody

Sign In for Pricing
View Details
BMP6 Antibody
orb1313083-03 100 µL

BMP6 Antibody

Sign In for Pricing
View Details
Pax-5 Polyclonal Antibody
MBS2539215-01 0.02 mL

Pax-5 Polyclonal Antibody

Sign In for Pricing
View Details