Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0292 (MJ0292)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0292 (MJ0292) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0292

UniProt

Q57740

Expression Region

1-93

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVMLMEQFIGIVKDILVLIASFGILLASYRLWIEKDRKNIIYARIHILGVIDCACFLIFI ALGETLLAFVYLILAPFLAHAIAHAAYNDNLSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KHDRBS2 Human Gene Knockout Kit (CRISPR)
KN405428 1 Kit

KHDRBS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SERPINB5 Protein Vector (Rat) (pPB-N-His)
PV304315 500 ng

SERPINB5 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Cleaved Gasdermin D (Asp276) (E3E3P) Rabbit Monoclonal Antibody
CST 10137T 20 µL

Cleaved Gasdermin D (Asp276) (E3E3P) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
C-Kit/CD117 Polyclonal Antibody, HRP Conjugated
bs-20716R-HRP 100 µL

C-Kit/CD117 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Zika virus NS5 Antibody
NBP3-13209 100 µL

Rabbit Polyclonal Zika virus NS5 Antibody

Sign In for Pricing
View Details
Olr1472 Protein Vector (Rat) (pPB-N-His)
PV288291 500 ng

Olr1472 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details