Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Leukocyte-specific transcript 1 protein (LST1)

This Recombinant Macaca mulatta Leukocyte-specific transcript 1 protein (LST1) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Leukocyte-specific transcript 1 protein

UniProt

Q5TM23

Expression Region

1-93

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIHVYTSTGAWGWAGSCCWLWSFCPPACIGCIEEHLLSWPQVQGSSEQEIHYASLQRLPV SSSEGPDLRDRDKRGTKEDPRADYACIAENKPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CEACAM8 Protein
E30P01888A 50 µg

Recombinant Human CEACAM8 Protein

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Protein KIAA0664 homolog (cluA), partial
MBS1173560 Inquire

Recombinant Dictyostelium discoideum Protein KIAA0664 homolog (cluA), partial

Sign In for Pricing
View Details
Recombinant Serratia marcescens HTH-type transcriptional regulator merD (merD)
MBS1112176-01 0.02 mg (E-Coli)

Recombinant Serratia marcescens HTH-type transcriptional regulator merD (merD)

Sign In for Pricing
View Details
Recombinant Serratia marcescens HTH-type transcriptional regulator merD (merD)
MBS1112176-02 0.1 mg (E-Coli)

Recombinant Serratia marcescens HTH-type transcriptional regulator merD (merD)

Sign In for Pricing
View Details
Recombinant Serratia marcescens HTH-type transcriptional regulator merD (merD)
MBS1112176-03 0.02 mg (Yeast)

Recombinant Serratia marcescens HTH-type transcriptional regulator merD (merD)

Sign In for Pricing
View Details
Recombinant Serratia marcescens HTH-type transcriptional regulator merD (merD)
MBS1112176-04 0.1 mg (Yeast)

Recombinant Serratia marcescens HTH-type transcriptional regulator merD (merD)

Sign In for Pricing
View Details