Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Leukocyte-specific transcript 1 protein (LST1)

This Recombinant Macaca mulatta Leukocyte-specific transcript 1 protein (LST1) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Leukocyte-specific transcript 1 protein

UniProt

Q5TM23

Expression Region

1-93

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIHVYTSTGAWGWAGSCCWLWSFCPPACIGCIEEHLLSWPQVQGSSEQEIHYASLQRLPV SSSEGPDLRDRDKRGTKEDPRADYACIAENKPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSN (Gelsolin) BioAssayTM ELISA Kit (Human) discontinued
356135-01 48 Tests

GSN (Gelsolin) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
GSN (Gelsolin) BioAssayTM ELISA Kit (Human) discontinued
356135-02 96 Tests

GSN (Gelsolin) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Human OXER1 Protein Lysate 20ug
IHUOXER1PLLY20UG 20 µg

Human OXER1 Protein Lysate 20ug

Sign In for Pricing
View Details
CSF1R Antibody (Phospho-Tyr809) : FITC (OAAF00189-FITC)
OAAF00189-100UG-FITC 100 µg

CSF1R Antibody (Phospho-Tyr809) : FITC (OAAF00189-FITC)

Sign In for Pricing
View Details
hsa-miR-24 miRNA Inhibitor
MIH01615 2x 5.0 nmol

hsa-miR-24 miRNA Inhibitor

Sign In for Pricing
View Details
Nutlin-3b
MBS3605579-01 2 mg

Nutlin-3b

Sign In for Pricing
View Details