Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Leukocyte-specific transcript 1 protein (LST1)

This Recombinant Macaca mulatta Leukocyte-specific transcript 1 protein (LST1) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Leukocyte-specific transcript 1 protein

UniProt

Q5TM23

Expression Region

1-93

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIHVYTSTGAWGWAGSCCWLWSFCPPACIGCIEEHLLSWPQVQGSSEQEIHYASLQRLPV SSSEGPDLRDRDKRGTKEDPRADYACIAENKPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear Matrix Protein p84 (THOC1) (NM_005131) Human Over-expression Lysate
LC401574 20 µg

Nuclear Matrix Protein p84 (THOC1) (NM_005131) Human Over-expression Lysate

Sign In for Pricing
View Details
OXSR1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-2927R-BF594 100 µL

OXSR1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Recombinant Rabbit Arginase (ARG)
RPU58748-01 50 µg

Recombinant Rabbit Arginase (ARG)

Sign In for Pricing
View Details
Recombinant Rabbit Arginase (ARG)
RPU58748-02 100 µg

Recombinant Rabbit Arginase (ARG)

Sign In for Pricing
View Details
Recombinant Rabbit Arginase (ARG)
RPU58748-03 1 mg

Recombinant Rabbit Arginase (ARG)

Sign In for Pricing
View Details
HAP1 Antibody, FITC conjugated
CSB-PA010129LC01HU-01 50 μL

HAP1 Antibody, FITC conjugated

Sign In for Pricing
View Details