Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Leukocyte-specific transcript 1 protein (LST1)

This Recombinant Macaca mulatta Leukocyte-specific transcript 1 protein (LST1) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Leukocyte-specific transcript 1 protein

UniProt

Q5TM23

Expression Region

1-93

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIHVYTSTGAWGWAGSCCWLWSFCPPACIGCIEEHLLSWPQVQGSSEQEIHYASLQRLPV SSSEGPDLRDRDKRGTKEDPRADYACIAENKPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ARHGAP15 sgRNA gene knockout kit - Lentiviral human ARHGAP15 sgRNA gene knockout kit (25)
GTR15377085 1 Vial

Lentiviral human ARHGAP15 sgRNA gene knockout kit - Lentiviral human ARHGAP15 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Bis-aminooxy-PEG2 dihydrochloride
YDA62771-01 25 mg

Bis-aminooxy-PEG2 dihydrochloride

Sign In for Pricing
View Details
Bis-aminooxy-PEG2 dihydrochloride
YDA62771-02 50 mg

Bis-aminooxy-PEG2 dihydrochloride

Sign In for Pricing
View Details
Bis-aminooxy-PEG2 dihydrochloride
YDA62771-03 100 mg

Bis-aminooxy-PEG2 dihydrochloride

Sign In for Pricing
View Details
Etimizol 100mg
A15085-100 100 mg

Etimizol 100mg

Sign In for Pricing
View Details
BX471
C12808-25mg 25 mg

BX471

Sign In for Pricing
View Details