Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0233 membrane protein MAP_0013c (MAP_0013c)

This Recombinant UPF0233 membrane protein MAP_0013c (MAP_0013c) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

UPF0233 membrane protein MAP_0013c

UniProt

Q744R9

Expression Region

1-93

Origin

Mycobacterium paratuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPKSKVRKKNDFTVSAVSRTPVKVKVGPSSVWFVALFIGLMLIGLVWLMVFQLAAVGSQA PTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CDKN1B Antibody
RC-4711-01 50 μL

Recombinant CDKN1B Antibody

Sign In for Pricing
View Details
Recombinant CDKN1B Antibody
RC-4711-02 100 µL

Recombinant CDKN1B Antibody

Sign In for Pricing
View Details
Recombinant CDKN1B Antibody
RC-4711-03 1 mL

Recombinant CDKN1B Antibody

Sign In for Pricing
View Details
Formic Acid, 97+%
TRC-F692895-250G 250 g

Formic Acid, 97+%

Sign In for Pricing
View Details
Copb1 Mouse Gene Knockout Kit (CRISPR)
KN503676 1 Kit

Copb1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Podophyllotoxin 4-O-Glucoside
TRC-P681010-1MG 1 mg

Podophyllotoxin 4-O-Glucoside

Sign In for Pricing
View Details