Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neurospora crassa Mitochondrial inner membrane organizing system protein NCU06495 (NCU06495)

This Recombinant Neurospora crassa Mitochondrial inner membrane organizing system protein NCU06495 (NCU06495) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane organizing system protein NCU06495

UniProt

Q7RYI0

Expression Region

1-93

Origin

Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDSTSSPVAAAPSTAMTRPVSEALLNEKWDRCLSNLLIKSTLGLGFGVVFSVLIFKRRA WPAFVGVGFGAGRAYEECNTSLKQAAREIRAQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-500 1x 500 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-100 1x 100 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (2H11 + 6E1), CF594 conjugate, 0.1mg/mL
BNC940724-100 1x 100 µL

Thyroglobulin (2H11 + 6E1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD33 (C33/69), CF405S conjugate, 0.1mg/mL
BNC040069-100 1x 100 µL

CD33 (C33/69), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF405S conjugate, 0.1mg/mL
BNC042345-500 1x 500 µL

CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details