Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalt transport protein CbiN (cbiN)

This Recombinant Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

Q8Z5N3

Expression Region

1-93

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKTLMLLAMVVALVILPFFINHGGEYGGSDGEAESQIQALAPQYKPWFQPLYEPASGEI ESLLFTLQGSLGAAVIFYILGYCKGKQRRDDRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROR2 Human qPCR Primer Pair (NM_004560)
HP207855 200 Reactions

ROR2 Human qPCR Primer Pair (NM_004560)

Sign In for Pricing
View Details
Capric Acid (n-Decanoic Acid) pure, C10-99%
23764-01 250 mL

Capric Acid (n-Decanoic Acid) pure, C10-99%

Sign In for Pricing
View Details
Capric Acid (n-Decanoic Acid) pure, C10-99%
23764-02 500 mL

Capric Acid (n-Decanoic Acid) pure, C10-99%

Sign In for Pricing
View Details
Capric Acid (n-Decanoic Acid) pure, C10-99%
23764-03 2500 mL

Capric Acid (n-Decanoic Acid) pure, C10-99%

Sign In for Pricing
View Details
Guinea Pig Cytochrome c oxidase subunit 5B, mitochondrial (COX5B) ELISA kit
GTR10401838 96 Well

Guinea Pig Cytochrome c oxidase subunit 5B, mitochondrial (COX5B) ELISA kit

Sign In for Pricing
View Details
CPA4, CT (Carboxypeptidase A4, Carboxypeptidase A3, UNQ694/PRO1339, CPA3)
C1204-11 200 µL

CPA4, CT (Carboxypeptidase A4, Carboxypeptidase A3, UNQ694/PRO1339, CPA3)

Sign In for Pricing
View Details