Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalt transport protein CbiN (cbiN)

This Recombinant Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

Q8Z5N3

Expression Region

1-93

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKTLMLLAMVVALVILPFFINHGGEYGGSDGEAESQIQALAPQYKPWFQPLYEPASGEI ESLLFTLQGSLGAAVIFYILGYCKGKQRRDDRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myl9 (NM_172118) Mouse Tagged ORF Clone Lentiviral Particle
MR201455L3V 200 µL

Myl9 (NM_172118) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human PADI2 Knockout HEK293T cell line
GTR15422612 1 Vial

Human PADI2 Knockout HEK293T cell line

Sign In for Pricing
View Details
Anti-Dynein axonemal intermediate chain Rabbit pAb
GB114246-50 50 μL

Anti-Dynein axonemal intermediate chain Rabbit pAb

Sign In for Pricing
View Details
PRIM2 siRNA (Rat)
orb1829139-01 15 nmol

PRIM2 siRNA (Rat)

Sign In for Pricing
View Details
PRIM2 siRNA (Rat)
orb1829139-02 30 nmol

PRIM2 siRNA (Rat)

Sign In for Pricing
View Details
PDHB Protein Vector (Mouse) (pPB-N-His)
PV214747 500 ng

PDHB Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details