Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0233 membrane protein Mb0011c (Mb0011c)

This Recombinant UPF0233 membrane protein Mb0011c (Mb0011c) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

UPF0233 membrane protein Mb0011c

UniProt

P67377

Expression Region

1-93

Origin

Mycobacterium bovis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQA PTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-100 1x 100 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-100 1x 100 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-500 1x 500 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1467), CF568 conjugate, 0.1mg/mL
BNC681467-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/1467), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/1009), CF405S conjugate, 0.1mg/mL
BNC041009-100 1x 100 µL

CD66 (CEA) (C66/1009), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details