Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Signal peptidase complex subunit SPC1 (SPC1)

This Recombinant Saccharomyces cerevisiae Signal peptidase complex subunit SPC1 (SPC1) spans the amino acid sequence from region 1-94.

Product Specifications

Product Name Alternative

Signal peptidase complex subunit SPC1, Microsomal signal peptidase subunit 1

UniProt

P46965

Expression Region

1-94

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISC VITLICVLPAYPWYNKQKLRWAQPKIEINVDQYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
BNC400266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (HCAM/918), CF640R conjugate, 0.1mg/mL
BNC400918-100 1x 100 µL

CD44 Standard (HCAM/918), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2760), CF568 conjugate, 0.1mg/mL
BNC682760-500 1x 500 µL

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2760), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (C6/372 + 3F7B5), CF640R conjugate, 0.1mg/mL
BNC401228-100 1x 100 µL

CD6 (C6/372 + 3F7B5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2641), CF405S conjugate, 0.1mg/mL
BNC042641-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2641), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF640R conjugate, 0.1mg/mL
BNC401274-100 1x 100 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details