Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thiomicrospira crunogena ATP synthase subunit c (atpE)

This Recombinant Thiomicrospira crunogena ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-94.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q31DL5

Expression Region

1-94

Origin

Thiomicrospira crunogena (strain XCL-2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAQFIADIYAATAIGVGVILAAAGLGSAIGWGLICSKTLEGIARQPEMRPALMTNMFIF AGLMESFPFIILAFAMWFLFANPFVGAMQAALGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNPLA5 Human Gene Knockout Kit (CRISPR)
KN418118 1 Kit

PNPLA5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ISLR (NM_201526) Human Over-expression Lysate
LC404439 20 µg

ISLR (NM_201526) Human Over-expression Lysate

Sign In for Pricing
View Details
Caspase 3 (CASP3) Mouse Monoclonal Antibody [Clone ID: OTI7B8]
CF813276 100 µg

Caspase 3 (CASP3) Mouse Monoclonal Antibody [Clone ID: OTI7B8]

Sign In for Pricing
View Details
Catenin, gamma (Cardiomyocyte Marker) (CTNG/2155R), CF647 conjugate, 0.1mg/mL
BNC472155-100 1x 100 µL

Catenin, gamma (Cardiomyocyte Marker) (CTNG/2155R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1700010I14Rik Mouse Gene Knockout Kit (CRISPR)
KN500075 1 Kit

1700010I14Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
rac-Falcarinol
TRC-F101100-1MG 1 mg

rac-Falcarinol

Sign In for Pricing
View Details