Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrosococcus oceani ATP synthase subunit c (atpE)

This Recombinant Nitrosococcus oceani ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-94.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3J6M6

Expression Region

1-94

Origin

Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPELLVSIYASTAVSVGIILAAAGLGSALGWGLICSKYLEGIARQPEMRPQLMGQMLFT GGLMEAFPMIVLGMSMWFIFANPFTGAALAAIGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-Chicken IgG (IgY) Heavy and Light Chain Cross-Adsorbed Antibody DyLight 800 Conjugated
MBS3902499-01 0.5 mg

Goat anti-Chicken IgG (IgY) Heavy and Light Chain Cross-Adsorbed Antibody DyLight 800 Conjugated

Sign In for Pricing
View Details
Goat anti-Chicken IgG (IgY) Heavy and Light Chain Cross-Adsorbed Antibody DyLight 800 Conjugated
MBS3902499-02 5x 0.5 mg

Goat anti-Chicken IgG (IgY) Heavy and Light Chain Cross-Adsorbed Antibody DyLight 800 Conjugated

Sign In for Pricing
View Details
Rituximab (Rituxan®) BioAssayTM ELISA Kit, Stop Solution discontinued discontinued
384865H 12 mL

Rituximab (Rituxan®) BioAssayTM ELISA Kit, Stop Solution discontinued discontinued

Sign In for Pricing
View Details
Histone H3K36me3 Antibody
HW010-01 50 µL

Histone H3K36me3 Antibody

Sign In for Pricing
View Details
Histone H3K36me3 Antibody
HW010-02 100 µL

Histone H3K36me3 Antibody

Sign In for Pricing
View Details
Somatostatin Receptor 1 Polyclonal Antibody, PE-Cy5 Conjugated
bs-1137R-PE-Cy5 100 µL

Somatostatin Receptor 1 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details