Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrosococcus oceani ATP synthase subunit c (atpE)

This Recombinant Nitrosococcus oceani ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-94.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3J6M6

Expression Region

1-94

Origin

Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPELLVSIYASTAVSVGIILAAAGLGSALGWGLICSKYLEGIARQPEMRPQLMGQMLFT GGLMEAFPMIVLGMSMWFIFANPFTGAALAAIGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUCLA2 (F-2)
sc-373959 200 µg/mL

SUCLA2 (F-2)

Sign In for Pricing
View Details
Lentiviral human CASK shRNA (UAS) - Lentiviral human CASK shRNA (UAS, GFP) plasmid
GTR15085930 1 Vial

Lentiviral human CASK shRNA (UAS) - Lentiviral human CASK shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
3,4-dihydro-2H-chromen-3-ylamine hydrochloride
sc-347352 1 g

3,4-dihydro-2H-chromen-3-ylamine hydrochloride

Sign In for Pricing
View Details
alpha TubuLin (TUBA1A) (NM_006009) Human Tagged Lenti ORF Clone
RC208669L1 10 µg

alpha TubuLin (TUBA1A) (NM_006009) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Sln Mouse shRNA Plasmid (Locus ID 66402)
TR519285 1 Kit

Sln Mouse shRNA Plasmid (Locus ID 66402)

Sign In for Pricing
View Details
Mouse Protein EMSY (EMSY) ELISA Kit
abx522008 96 Tests

Mouse Protein EMSY (EMSY) ELISA Kit

Sign In for Pricing
View Details