Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrosococcus oceani ATP synthase subunit c (atpE)

This Recombinant Nitrosococcus oceani ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-94.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3J6M6

Expression Region

1-94

Origin

Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPELLVSIYASTAVSVGIILAAAGLGSALGWGLICSKYLEGIARQPEMRPQLMGQMLFT GGLMEAFPMIVLGMSMWFIFANPFTGAALAAIGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLEKHB2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
36984124 3x 1.0µg DNA

PLEKHB2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
PP2A-B55-γ Lentiviral Activation Particles (h2)
sc-417893-LAC-2 200 µL

PP2A-B55-γ Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
N-Desmethyl Regorafenib (Pyridine) -N-oxide-d3
458819 1 mg

N-Desmethyl Regorafenib (Pyridine) -N-oxide-d3

Sign In for Pricing
View Details
Human CINP qPCR Primer Pair
QH41601S 200 Tests

Human CINP qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Vibrio harveyi Fatty acid oxidation complex subunit alpha (fadJ), partial
MBS1239335 Inquire

Recombinant Vibrio harveyi Fatty acid oxidation complex subunit alpha (fadJ), partial

Sign In for Pricing
View Details
MAPK6PS6 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV767217 1.0 µg DNA

MAPK6PS6 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details