Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0284005 (DDB_G0284005)

This Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0284005 (DDB_G0284005) spans the amino acid sequence from region 1-94.

Product Specifications

Product Name Alternative

Uncharacterized protein DDB_G0284005

UniProt

Q54QA8

Expression Region

1-94

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDEYTNDFPWMYIVICLTTIISVTIFYILVSFFIKRYRNRKNEELGHALITKIVYTPHYN SQPIINGSGHYSIINQPIQPQQQQPQNYYSSMIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-500 1x 500 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF740 conjugate, 0.1mg/mL
BNC741429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF488A conjugate, 0.1mg/mL
BNC880305-100 1x 100 µL

CD95 (B-R18), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
BNC551037-500 1x 500 µL

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/451), CF594 conjugate, 0.1mg/mL
BNC940451-500 1x 500 µL

HER-2 / CD340 (HRB2/451), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-500 1x 500 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details