Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein traQ (traQ)

This Recombinant Escherichia coli Protein traQ (traQ) spans the amino acid sequence from region 1-94.

Product Specifications

Product Name Alternative

Protein traQ

UniProt

P18033

Expression Region

1-94

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVL DAWIARVSREEREALEARQQAMMEGQQEGGHVSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CKI-γ2 Antibody
8C10793-AAT 50 µg

CKI-γ2 Antibody

Sign In for Pricing
View Details
Cytochrome P450 2A13 Antibody
8C12260-AAT 50 µg

Cytochrome P450 2A13 Antibody

Sign In for Pricing
View Details
Mouse Cd7 activation kit by CRISPRa
GA200635 1 Kit

Mouse Cd7 activation kit by CRISPRa

Sign In for Pricing
View Details
Apoptosis and Necrosis Quantitation Kit Plus (50 assays)
#30065 1 Kit

Apoptosis and Necrosis Quantitation Kit Plus (50 assays)

Sign In for Pricing
View Details
Barbituric Acid-13C,15N2
TRC-B118652-1MG 1 mg

Barbituric Acid-13C,15N2

Sign In for Pricing
View Details
CK19 Polyclonal Antibody
D-AB-10360L-01 25 µL

CK19 Polyclonal Antibody

Sign In for Pricing
View Details