Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein traQ (traQ)

This Recombinant Escherichia coli Protein traQ (traQ) spans the amino acid sequence from region 1-94.

Product Specifications

Product Name Alternative

Protein traQ

UniProt

P18033

Expression Region

1-94

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVL DAWIARVSREEREALEARQQAMMEGQQEGGHVSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Thymidine Kinase 1, Soluble (TK1) ELISA Kit
RDR-TK1-Hu-01 96 Tests

Human Thymidine Kinase 1, Soluble (TK1) ELISA Kit

Sign In for Pricing
View Details
Human Thymidine Kinase 1, Soluble (TK1) ELISA Kit
RDR-TK1-Hu-02 48 Tests

Human Thymidine Kinase 1, Soluble (TK1) ELISA Kit

Sign In for Pricing
View Details
PSA Sorbent
TRC-P839905-5G 5 g

PSA Sorbent

Sign In for Pricing
View Details
p53 Recombinant Rabbit Monoclonal Antibody [PSH03-95]
HA722074 100 µL

p53 Recombinant Rabbit Monoclonal Antibody [PSH03-95]

Sign In for Pricing
View Details
OR2G2 Antibody
8G547-AAT 50 µg

OR2G2 Antibody

Sign In for Pricing
View Details
3Beta-Cholic Acid-d5
TRC-C432607-1MG 1 mg

3Beta-Cholic Acid-d5

Sign In for Pricing
View Details