Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein traQ (traQ)

This Recombinant Escherichia coli Protein traQ (traQ) spans the amino acid sequence from region 1-94.

Product Specifications

Product Name Alternative

Protein traQ

UniProt

P18033

Expression Region

1-94

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVL DAWIARVSREEREALEARQQAMMEGQQEGGHVSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurogranin (NRGN) Human Gene Knockout Kit (CRISPR)
KN401209 1 Kit

Neurogranin (NRGN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cr1l Mouse Gene Knockout Kit (CRISPR)
KN503792 1 Kit

Cr1l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ARHGAP11B activation kit by CRISPRa
GA113937 1 Kit

Human ARHGAP11B activation kit by CRISPRa

Sign In for Pricing
View Details
6-Azabicyclo[3.2.1]octane Hydrochloride
TRC-S684588-500MG 500 mg

6-Azabicyclo[3.2.1]octane Hydrochloride

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Pan T Cells,  40nm
GM-25-40 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Pan T Cells, 40nm

Sign In for Pricing
View Details
RanBP9 Recombinant Rabbit Monoclonal Antibody [JE55-10]
ET7110-95 100 µL

RanBP9 Recombinant Rabbit Monoclonal Antibody [JE55-10]

Sign In for Pricing
View Details