Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein yebO (yebO)

This Recombinant Escherichia coli Uncharacterized protein yebO (yebO) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Uncharacterized protein yebO

UniProt

P64499

Expression Region

1-95

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEVVNSGVMNIASLVVSVVVLLIGLILWFFINRASSRTNEQIELLEALLDQQKRQNALL RRLCEANEPEKADKKTVESQKSVEDEDIIRLVAER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Cytokeratin 8/18 Antibody (KRT8.18/6579R) [Alexa Fluor 532]
NBP3-14099AF532 0.1 mL

Rabbit Monoclonal Cytokeratin 8/18 Antibody (KRT8.18/6579R) [Alexa Fluor 532]

Sign In for Pricing
View Details
DDB2 (DNA Damage-binding Protein 2, DDB p48 Subunit, DDBb, Damage-specific DNA-binding Protein 2, UV-damaged DNA-binding Protein 2, UV-DDB 2) (FITC)
MBS6146797-01 0.1 mL

DDB2 (DNA Damage-binding Protein 2, DDB p48 Subunit, DDBb, Damage-specific DNA-binding Protein 2, UV-damaged DNA-binding Protein 2, UV-DDB 2) (FITC)

Sign In for Pricing
View Details
DDB2 (DNA Damage-binding Protein 2, DDB p48 Subunit, DDBb, Damage-specific DNA-binding Protein 2, UV-damaged DNA-binding Protein 2, UV-DDB 2) (FITC)
MBS6146797-02 5x 0.1 mL

DDB2 (DNA Damage-binding Protein 2, DDB p48 Subunit, DDBb, Damage-specific DNA-binding Protein 2, UV-damaged DNA-binding Protein 2, UV-DDB 2) (FITC)

Sign In for Pricing
View Details
UTX/KDM6A Rabbit Polyclonal Antibody (Fluoro594)
orb3114617 100 µg

UTX/KDM6A Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Human Cytoplasmic Antiproteinase 3 (CAP3) ELISA Kit
RDR-CAP3-Hu-48Tests 48 Tests

Human Cytoplasmic Antiproteinase 3 (CAP3) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Serpinb13 shRNA (UAS) - Lentiviral mouse Serpinb13 shRNA (UAS) plasmid
GTR15197287 1 Vial

Lentiviral mouse Serpinb13 shRNA (UAS) - Lentiviral mouse Serpinb13 shRNA (UAS) plasmid

Sign In for Pricing
View Details