Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein yebO (yebO)

This Recombinant Escherichia coli Uncharacterized protein yebO (yebO) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Uncharacterized protein yebO

UniProt

P64499

Expression Region

1-95

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEVVNSGVMNIASLVVSVVVLLIGLILWFFINRASSRTNEQIELLEALLDQQKRQNALL RRLCEANEPEKADKKTVESQKSVEDEDIIRLVAER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGER2 Polyclonal Antibody, PE Conjugated
bs-4196R-PE-01 20 µL

PTGER2 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
PTGER2 Polyclonal Antibody, PE Conjugated
bs-4196R-PE-02 100 µL

PTGER2 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
BOD1 siRNA (Rat)
orb1830038-01 15 nmol

BOD1 siRNA (Rat)

Sign In for Pricing
View Details
BOD1 siRNA (Rat)
orb1830038-02 30 nmol

BOD1 siRNA (Rat)

Sign In for Pricing
View Details
LAPSER1 (D-7) Alexa Fluor® 488
sc-514618 AF488 200 µg/mL

LAPSER1 (D-7) Alexa Fluor® 488

Sign In for Pricing
View Details
RND2 (Rho-Related GTP-binding Protein RhoN, Rho Family GTPase 2, Rho-Related GTP-binding Protein Rho7, Rnd2, ARHN, RHO7) discontinued
361098-01 50 µL

RND2 (Rho-Related GTP-binding Protein RhoN, Rho Family GTPase 2, Rho-Related GTP-binding Protein Rho7, Rnd2, ARHN, RHO7) discontinued

Sign In for Pricing
View Details