Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yebO (yebO)

This Recombinant Uncharacterized protein yebO (yebO) spans the amino acid sequence from region 1-95.

Product Specifications

Product Name Alternative

Uncharacterized protein yebO

UniProt

P64502

Expression Region

1-95

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDVLNSGAFSLASLIVSMVVLVVGLALWFFVNRASSRANEQIELLEALLDQQKRQNALL RRLCEANEPEKEAEPATAASEPKEDEDIIRLVAER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea-pig CA2 (Carbonic Anhydrase II) ValidElisa Kit
EK347582 96 Well

Guinea-pig CA2 (Carbonic Anhydrase II) ValidElisa Kit

Sign In for Pricing
View Details
4-Methoxycatechol
orb2695041-01 50 mg

4-Methoxycatechol

Sign In for Pricing
View Details
4-Methoxycatechol
orb2695041-02 10 mg

4-Methoxycatechol

Sign In for Pricing
View Details
Recombinant Human Endocrine Gland-derived Vascular Endothelial Growth Factor
P1297-.005 5 µg

Recombinant Human Endocrine Gland-derived Vascular Endothelial Growth Factor

Sign In for Pricing
View Details
Hsa-miR-1243 antagomir
HY-RI00137A-01 5 nmol

Hsa-miR-1243 antagomir

Sign In for Pricing
View Details
Hsa-miR-1243 antagomir
HY-RI00137A-02 20 nmol

Hsa-miR-1243 antagomir

Sign In for Pricing
View Details